CYP17A1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A13968
Additional Names:: CPT7|CYP17|CYP17A1|P450C17|S17AH
Application:: ELISA, WB
Molecular Weight:: 57kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LSKDSLVDLVPWLKIFPNKTLEKLKSHVKIRNDLLNKILENYKEKFRSDSITNMLDTLMQAKMNSDNGNAGPDQDSELLSDNHILTTIGDIFGAGVETTTSVVKWTLAFLLHNPQVKKKLYEEIDQNVGFSRTPTISDRNRLLLLEATIREVLRLRPVAPMLIPHKANVDSSIGEFAVDKGTEVIINLWALHHNEKEWHQPDQFMPERFLNPAGTQLISPSVSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPDDGQLPSLEGIPKVVFLIDSFKVKIKVRQAWREAQAEGST
Uniprot:: P05093
Synonyms:: 17-alpha-hydroxyprogesterone aldolase;CPT7;CYP17;CYPXVII;cytochrome P450 17A1;cytochrome p450 XVIIA1;cytochrome P450-C17;cytochrome P450, family 17, subfamily A, polypeptide 1;cytochrome P450, subfamily XVII (steroid 17-alpha-hydroxylase), adrenal hyperplasia;cytochrome P450c17;P450C17;S17AH;steroid 17-alpha-hydroxylase/17,20 lyase;steroid 17-alpha-monooxygenase
Extra Details:: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. It has both 17alpha-hydroxylase and 17,20-lyase activities and is a key enzyme in the steroidogenic pathway that produces progestins, mineralocorticoids, glucocorticoids, androgens, and estrogens. Mutations in this gene are associated with isolated steroid-17 alpha-hydroxylase deficiency, 17-alpha-hydroxylase/17,20-lyase deficiency, pseudohermaphroditism, and adrenal hyperplasia.

Shipping Conditions:: Blue Ice