A13945
Annexin A5/Annexin V Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A13945
- Additional Names:
- Annexin A5/Annexin V|ANX5|CPB-I|ENX2|HEL-S-7|PP4|RPRGL3|VAC-alph
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 36kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD
- Uniprot:
- P08758
- Synonyms:
- anchorin CII;annexin A5;annexin V;annexin-5;ANX5;calphobindin I;CBP-I;endonexin II;ENX2;epididymis secretory protein Li 7;HEL-S-7;lipocortin V;PAP-I;placental anticoagulant protein 4;placental anticoagulant protein I;PP4;RPRGL3;thromboplastin inhibitor;VAC-alpha;vascular anticoagulant-alpha
- Extra Details:
- The Annexin 5 gene spans 29 kb containing 13 exons, and encodes a single transcript of approximately 1.6 kb and a protein product with a molecular weight of about 35 kDa.The protein encoded by this gene belongs to the annexin family of calcium-dependent phospholipid binding proteins some of which have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Annexin 5 has also been described as placental anticoagulant protein I, vascular anticoagulant-alpha, endonexin II, lipocortin V, placental protein 4 and anchorin CII. Polymorphisms in this gene have been implicated in various obstetric complications.
- Shipping Conditions:
- Blue Ice