A13896
TRIM9 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A13896
- Additional Names:
- RNF91|SPRING|TRIM9
- Application:
- ELISA, WB
- Molecular Weight:
- 79kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MEEMEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPESESPQSHRAAGSGVSDYDYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPATHLSPALAPVPRNSCITCPQCHRSLILDDRGLRGFPKNRVLEGVIDRYQQ
- Uniprot:
- Q9C026
- Synonyms:
- E3 ubiquitin-protein ligase TRIM9;homolog of rat RING finger Spring;RING finger protein 91;RING-type E3 ubiquitin transferase TRIM9;RNF91;SNAP-25-interacting RING finger protein;SPRING;tripartite motif-containing protein 9
- Extra Details:
- The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. Its function has not been identified. Alternate splicing of this gene generates two transcript variants encoding different isoforms.
- Shipping Conditions:
- Blue Ice

