A13884
RNASEH2C Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A13884
- Additional Names:
- AGS3|AYP1|RNASEH2C
- Application:
- ELISA, WB
- Molecular Weight:
- 20kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MESGDEAAIERHRVHLRSATLRDAVPATLHLLPCEVAVDGPAPVGRFFTPAIRQGPEGLEVSFRGRCLRGEEVAVPPGLVGYVMVTEEKKVSMGKPDPLRDSGTDDQEEEPLERDFDRFIGATANFSRFTLWGLETIPGPDAKVRGALTWPSLAAAIHAQVPED
- Uniprot:
- Q8TDP1
- Synonyms:
- AGS3;aicardi-Goutieres syndrome 3 protein;AYP1;ribonuclease H2 subunit C;ribonuclease HI subunit C;RNase H1 small subunit;RNase H2 subunit C
- Extra Details:
- This gene encodes a ribonuclease H subunit that can cleave ribonucleotides from RNA:DNA duplexes. Mutations in this gene cause Aicardi-Goutieres syndrome-3, a disease that causes severe neurologic dysfunction. A pseudogene for this gene has been identified on chromosome Y, near the sex determining region Y (SRY) gene.
- Shipping Conditions:
- Blue Ice