A1388
FCGR2A Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A1388
- Additional Names:
- CD32|CD32A|CDw32|FCG2|FcgammaRIIa|FcGR|FCGR2|FCGR2A|FCGR2A1|IGFR2
- Application:
- ELISA, WB, IF
- Molecular Weight:
- 40-50kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- QAAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGIIVAVVIATAVAAIVAAVVALIYCRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN
- Uniprot:
- P12318
- Synonyms:
- CD32;CD32A;CDw32;Fc fragment of IgG, low affinity IIa, receptor (CD32);Fc gamma receptor RIIa3;Fc-gamma RII-a;fc-gamma-RIIa;FCG2;FcGR;FCGR2;FCGR2A1;fcRII-a;IGFR2;igG Fc receptor II-a;Immunoglobulin G Fc receptor II;low affinity immunoglobulin gamma Fc region receptor II-a
- Extra Details:
- This gene encodes one member of a family of immunoglobulin Fc receptor genes found on the surface of many immune response cells. The protein encoded by this gene is a cell surface receptor found on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice