PLA2G7 Rabbit polyclonal antibody

Size

£152.00

SKU:: A13864
Additional Names:: LDL-PLA2|LP-PLA2|PAFAD|PAFAH|PLA2G7
Application:: ELISA, WB
Molecular Weight:: 55kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: FGQTKIPRGNGPYSVGCTDLMFDHTNKGTFLRLYYPSQDNDRLDTLWIPNKEYFWGLSKFLGTHWLMGNILRLLFGSMTTPANWNSPLRPGEKYPLVVFSHGLGAFRTLYSAIGIDLASHGFIVAAVEHRDRSASATYYFKDQSAAEIGDKSWLYLRTLKQEEETHIRNEQVRQRAKECSQALSLILDID
Uniprot:: Q13093
Synonyms:: 1-alkyl-2-acetylglycerophosphocholine esterase;2-acetyl-1-alkylglycerophosphocholine esterase;group-VIIA phospholipase A2;gVIIA-PLA2;LDL-associated phospholipase A2;LDL-PLA(2);LDL-PLA2;lipoprotein-associated phospholipase A2;LP-PLA2;PAF 2-acylhydrolase;PAF acetylhydrolase;PAFAD;PAFAH;phospholipase A2, group VII (platelet-activating factor acetylhydrolase, plasma);platelet-activating factor acetylhydrolase
Extra Details:: The protein encoded by this gene is a secreted enzyme that catalyzes the degradation of platelet-activating factor to biologically inactive products. Defects in this gene are a cause of platelet-activating factor acetylhydrolase deficiency. Two transcript variants encoding the same protein have been found for this gene.