A13864
PLA2G7 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A13864
- Additional Names:
- LDL-PLA2|LP-PLA2|PAFAD|PAFAH|PLA2G7
- Application:
- ELISA, WB
- Molecular Weight:
- 55kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- FGQTKIPRGNGPYSVGCTDLMFDHTNKGTFLRLYYPSQDNDRLDTLWIPNKEYFWGLSKFLGTHWLMGNILRLLFGSMTTPANWNSPLRPGEKYPLVVFSHGLGAFRTLYSAIGIDLASHGFIVAAVEHRDRSASATYYFKDQSAAEIGDKSWLYLRTLKQEEETHIRNEQVRQRAKECSQALSLILDID
- Uniprot:
- Q13093
- Synonyms:
- 1-alkyl-2-acetylglycerophosphocholine esterase;2-acetyl-1-alkylglycerophosphocholine esterase;group-VIIA phospholipase A2;gVIIA-PLA2;LDL-associated phospholipase A2;LDL-PLA(2);LDL-PLA2;lipoprotein-associated phospholipase A2;LP-PLA2;PAF 2-acylhydrolase;PAF acetylhydrolase;PAFAD;PAFAH;phospholipase A2, group VII (platelet-activating factor acetylhydrolase, plasma);platelet-activating factor acetylhydrolase
- Extra Details:
- The protein encoded by this gene is a secreted enzyme that catalyzes the degradation of platelet-activating factor to biologically inactive products. Defects in this gene are a cause of platelet-activating factor acetylhydrolase deficiency. Two transcript variants encoding the same protein have been found for this gene.
- Shipping Conditions:
- Blue Ice

