A13844
NOXA1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A13844
- Additional Names:
- NOXA1|NY-CO-31|p51NOX|SDCCAG31
- Application:
- ELISA, WB
- Molecular Weight:
- 50kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- EAASSLREAMSKWPEGSLNGLDSALDQVQRRGSLPPRQVPRGEVFRPHRWHLKHLEPVDFLGKAKVVASAIPDDQGWGVRPQQPQGPGANHDARSLIMDSPRAGTHQGPLDAETEVGADRCTSTAYQEQRPQVEQVGKQAPLSPGLPAMGGPGPGPCEDPA
- Uniprot:
- Q86UR1
- Synonyms:
- antigen NY-CO-31;inhibitory NADPH oxidase activator 1;NADPH oxidase activator 1;NCF2-like protein;Nox activator 1;NY-CO-31;p51-nox;p51NOX;p67phox-like factor;SDCCAG31;serologically defined colon cancer antigen 31
- Extra Details:
- This gene encodes a protein which activates NADPH oxidases, enzymes which catalyze a reaction generating reactive oxygen species. The encoded protein contains four N-terminal tetratricopeptide domains and a C-terminal Src homology 3 domain. Interaction between the encoded protein and proteins in the oxidase regulatory complex occur via the tetratricopeptide domains. Multiple transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice

