ARPC2 Rabbit monoclonal antibody

Size

POA

SKU:: A1382
Additional Names:: ARC34|ARPC2|p34-Arc|PNAS-139|PRO2446
Application:: ELISA, WB, IF, ICC, IP
Molecular Weight:: 34kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: FSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTFSSR
Uniprot:: O15144
Synonyms:: actin related protein 2/3 complex, subunit 2, 34kDa;actin-related protein 2/3 complex subunit 2;ARC34;arp2/3 complex 34 kDa subunit;ARP2/3 protein complex subunit 34;p34-Arc;PNAS-139;PRO2446;testis tissue sperm-binding protein Li 53e
Extra Details:: This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein encoded by this gene, the p34 subunit, has yet to be determined. Two alternatively spliced variants have been characterized to date. Additional alternatively spliced variants have been described but their full length nature has not been determined.