UBR5 Rabbit polyclonal antibody

Size

£152.00

SKU:: A13816
Additional Names:: DD5|EDD|EDD1|HYD|UBR5
Application:: ELISA, WB
Molecular Weight:: 300kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: SISAGIPKVGVLMESVWNMNDSCRFQLRSPESLKNMEKASKTTEAKPESKQEPVKTEMGPPPSPASTCSDASSIASSASMPYKRRRSTPAPKEEEKVNEEQWSLREVVFVEDVKNVPVGKVLKVDGAYVAVKFPGTSSNTNCQNSSGPDADPSSLLQDCRLLRIDELQVVKTGGTPKVPDCFQRTPKKLCIPEKTEILAVNVDSKGVHAVL
Uniprot:: O95071
Synonyms:: DD5;E3 identified by differential display;E3 ubiquitin-protein ligase UBR5;E3 ubiquitin-protein ligase, HECT domain-containing 1;EDD;EDD1;HECT-type E3 ubiquitin transferase UBR5;HYD;hyperplastic discs protein homolog;progestin-induced protein
Extra Details:: This gene encodes a progestin-induced protein, which belongs to the HECT (homology to E6-AP carboxyl terminus) family. The HECT family proteins function as E3 ubiquitin-protein ligases, targeting specific proteins for ubiquitin-mediated proteolysis. This gene is localized to chromosome 8q22 which is disrupted in a variety of cancers. This gene potentially has a role in regulation of cell proliferation or differentiation.