A13805
ATP1A2 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A13805
- Additional Names:
- ATP1A2|DEE98|FARIMPD|FHM2|MHP2
- Application:
- ELISA, WB
- Molecular Weight:
- 112kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MGRGAGREYSPAATTAENGGGKKKQKEKELDELKKEVAMDDHKLSLDELGRKYQVDLSKGLTNQRAQDVL
- Uniprot:
- P50993
- Synonyms:
- ATPase Na+/K+ transporting alpha 2 polypeptide;FHM2;MHP2;Na(+)/K(+) ATPase alpha-2 subunit;Na+/K+ ATPase, alpha-A(+) catalytic polypeptide;Na+/K+ ATPase, alpha-B polypeptide;sodium pump subunit alpha-2;sodium-potassium ATPase catalytic subunit alpha-2;sodium/potassium-transporting ATPase alpha-2 chain;sodium/potassium-transporting ATPase subunit alpha-2
- Extra Details:
- The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The catalytic subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes an alpha 2 subunit. Mutations in this gene result in familial basilar or hemiplegic migraines, and in a rare syndrome known as alternating hemiplegia of childhood.
- Shipping Conditions:
- Blue Ice