FCRL5 Rabbit polyclonal antibody

Size

£152.00

SKU:: A13803
Additional Names:: BXMAS1|CD307|CD307e|FCRH5|FCRL5|IRTA2|PRO820
Application:: ELISA, WB
Molecular Weight:: 106kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: QFARTPRPIIFLQPPWTTVFQGERVTLTCKGFRFYSPQKTKWYHRYLGKEILRETPDNILEVQESGEYRCQAQGSPLSSPVHLDFSSASLILQAPLSVFEGDSVVLRCRAKAEVTLNNTIYKNDNVLAFLNKRTDFHIPHACLKDNGAYRCTGYKESCCPVSSNTVKIQVQEPFT
Uniprot:: Q96RD9
Synonyms:: BXMAS1;CD307;CD307e;fc receptor homolog 5;Fc receptor-like protein 5;fcR-like protein 5;FCRH5;immune receptor translocation-associated protein 2;immunoglobulin superfamily receptor translocation associated 2 (IRTA2);IRTA2;PRO820
Extra Details:: This gene encodes a member of the immunoglobulin receptor superfamily and the Fc-receptor like family. This gene and several other Fc receptor-like gene members are clustered on the long arm of chromosome 1. The encoded protein is a single-pass type I membrane protein and contains 8 immunoglobulin-like C2-type domains. This gene is implicated in B cell development and lymphomagenesis. Alternatively spliced transcript variants encoding different isoforms have been identified.