A13799
NCOA7 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A13799
- Additional Names:
- dJ187J11.3|ERAP140|ESNA1|Nbla00052|Nbla10993|NCOA7|NCOA7-AS|TLDC4
- Application:
- ELISA, WB
- Molecular Weight:
- 106kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MDTKEEKKERKQSYFARLKKKKQAKQNAETASAVATRTHTGKEDNNTVVLEPDKCNIAVEEEYMTDEKKKRKSNQLKEIRRTELKRYYSI
- Uniprot:
- Q8NI08
- Synonyms:
- 140 kDa estrogen receptor-associated protein;dJ187J11.3;ERAP140;ESNA1;estrogen nuclear receptor coactivator 1;estrogen receptor associated protein 140 kDa;Nbla00052;Nbla10993;NCOA7-AS;nuclear receptor coactivator 7;putative protein product of Nbla00052;putative protein product of Nbla10993;TBC/LysM-associated domain containing 4;TLDC4
- Extra Details:
- Enables nuclear receptor binding activity and nuclear receptor coactivator activity. Involved in positive regulation of transcription by RNA polymerase II. Predicted to be active in nucleus.
- Shipping Conditions:
- Blue Ice