A13785
ELMO2 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A13785
- Additional Names:
- CED-12|Ced-12A|CED12|ELMO-2|ELMO2|VMPI
- Application:
- ELISA, WB
- Molecular Weight:
- 83kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- SLPNPEYYTLRYADGPQLYITEQTRSDIKNGTILQLAISPSRAARQLMERTQSSNMETRLDAMKELAKLSADVTFATEF
- Uniprot:
- Q96JJ3
- Synonyms:
- CED-12;ced-12 homolog 2;Ced-12A;CED12;ELMO-2;engulfment and cell motility protein 2;PH domain protein CED12A;protein ced-12 homolog A;VMPI
- Extra Details:
- The protein encoded by this gene interacts with the dedicator of cyto-kinesis 1 protein. Similarity to a C. elegans protein suggests that this protein may function in phagocytosis of apoptotic cells and in cell migration. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice