A13773
PAPSS1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A13773
- Additional Names:
- ATPSK1|PAPSS|PAPSS1|SK1
- Application:
- ELISA, WB
- Molecular Weight:
- 71kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- SEYEKPEAPELVLKTDSCDVNDCVQQVVELLQERDIVPVDASYEVKELYVPENKLHLAKTDAETLPALKIN
- Uniprot:
- O43252
- Synonyms:
- 3-prime-phosphoadenosine 5-prime-phosphosulfate synthase 1;adenylyl-sulfate kinase;ATPSK1;bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1;PAPS synthase 1;PAPSS;PAPSS 1;SK 1;SK1;sulfate adenylyltransferase;sulfurylase kinase 1
- Extra Details:
- Three-prime-phosphoadenosine 5-prime-phosphosulfate (PAPS) is the sulfate donor cosubstrate for all sulfotransferase (SULT) enzymes (Xu et al., 2000 [PubMed 10679223]). SULTs catalyze the sulfate conjugation of many endogenous and exogenous compounds, including drugs and other xenobiotics. In humans, PAPS is synthesized from adenosine 5-prime triphosphate (ATP) and inorganic sulfate by 2 isoforms, PAPSS1 and PAPSS2 (MIM 603005).
- Shipping Conditions:
- Blue Ice

