A13767
P4HA3 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A13767
- Additional Names:
- P4HA3
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 70kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- DPERAAARGDTFSALTSVARALAPERRLLGLLRRYLRGEEARLRDLTRFYDKVLSLHEDSTTPVANPLLAFTLIKRLQSDWRNVVHSLEAS
- Uniprot:
- Q7Z4N8
- Synonyms:
- 4-PH alpha-3;C-P4H alpha III;collagen prolyl 4-hydroxylase alpha(III);procollagen-proline, 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase), alpha polypeptide III;Procollagen-proline,2-oxoglutarate-4-dioxygenase subunit alpha-3;prolyl 4-hydroxylase subunit alpha-3;prolyl 4-hydroxylase, alpha polypeptide III
- Extra Details:
- This gene encodes a component of prolyl 4-hydroxylase, a key enzyme in collagen synthesis composed of two identical alpha subunits and two beta subunits. The encoded protein is one of several different types of alpha subunits and provides the major part of the catalytic site of the active enzyme. In collagen and related proteins, prolyl 4-hydroxylase catalyzes the formation of 4-hydroxyproline that is essential to the proper three-dimensional folding of newly synthesized procollagen chains. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice





