A13760
IFIT2 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A13760
- Additional Names:
- cig42|G10P2|GARG-39|IFI-54|IFI-54K|IFI54|IFIT-2|IFIT2|ISG-54|ISG-54 K|ISG-54K|ISG54|P54
- Application:
- ELISA, WB
- Molecular Weight:
- 50 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- ALEYIPNNAYLHCQIGCCYRAKVFQVMNLRENGMYGKRKLLELIGHAVAHLKKADEANDNLFRVCSILASLHALADQYEDAEYYFQKEFSKELTPVAKQLLHLRYGNFQLYQMKCEDKAIHHFIEGVKINQKSREKEKMKDKLQKIAKMRLSKNGADSEALHVLAFLQELNEKMQQADEDSERGLESGSLIPSASSWNGE
- Uniprot:
- P09913
- Synonyms:
- cig42;G10P2;GARG-39;IFI-54;IFI-54K;IFI54;IFIT-2;interferon-induced 54 kDa protein;interferon-induced protein 54;interferon-induced protein with tetratricopeptide repeats 2;Interferon, alpha-inducible protein (MW 54kD);ISG-54;ISG-54 K;ISG-54K;ISG54;P54
- Extra Details:
- Enables RNA binding activity. Involved in negative regulation of protein binding activity; positive regulation of apoptotic process; and response to virus. Located in endoplasmic reticulum.
- Shipping Conditions:
- Blue Ice

