A13752
CMAS Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A13752
- Additional Names:
- CMAS|CSS
- Application:
- ELISA, WB
- Molecular Weight:
- 48kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MDSVEKGAATSVSNPRGRPSRGRPPKLQRNSRGGQGRGVEKPPHLAALILARGGSKGIPLKNIKHLAGVPLIGWVLRAALDSGAFQSVWVSTDHDEIENVAKQFGAQVHRRSSEVSKDSSTSLDAIIEFLNYHNEVDIVGNIQATSPCLHPTDLQKVAEMIREEGYDSVFSVVRRHQFRWSEIQKGVREVTEPLNLNPAKRPRRQDWDGELYENGSFYFAKRHLIEMGYLQGGKMAYYEMRAEHSVDIDVDIDWPIAEQRVLR
- Uniprot:
- Q8NFW8
- Synonyms:
- CMP-N-acetylneuraminic acid synthase;CMP-N-acetylneuraminic acid synthetase;CMP-Neu5Ac synthetase;CMP-NeuNAc synthase;CMP-NeuNAc synthetase;CMP-sialic acid synthetase;CSS;cytidine 5'-monophosphate N-acetylneuraminic acid synthetase;N-acylneuraminate cytidylyltransferase
- Extra Details:
- This gene encodes an enzyme that converts N-acetylneuraminic acid (NeuNAc) to cytidine 5'-monophosphate N-acetylneuraminic acid (CMP-NeuNAc). This process is important in the formation of sialylated glycoprotein and glycolipids. This modification plays a role in cell-cell communications and immune responses. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice