CABP7 Rabbit polyclonal antibody

Size

£152.00

SKU:: A13703
Additional Names:: CABP7|CALN2
Application:: ELISA, WB, IHC-P
Molecular Weight:: 30kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: PKLSTSGIPEKFHGTDFDTVFWKCDMQKLTVDELKRLLYDTFCEHLSMKDIENIIMTEEESHLGTAEECPVDVETCSNQQI
Uniprot:: Q86V35
Synonyms:: calcium-binding protein 7;CALN2;calneuron 2;calneuron II;Calneuron-2
Extra Details:: Predicted to enable calcium ion binding activity. Located in trans-Golgi network membrane.