THOC7 Rabbit polyclonal antibody

Size

£152.00

SKU:: A13700
Additional Names:: fSAP24|hTREX30|NIF3L1BP1|THOC7
Application:: ELISA, WB
Molecular Weight:: 24kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MGAVTDDEVIRKRLLIDGDGAGDDRRINLLVKSFIKWCNSGSQEEGYSQYQRMLSTLSQCEFSMGKTLLVYDMNLREMENYEKIYKEIECSIAGAHEKIAECKKQILQAKRIRKNRQEYDALAKVIQHHPDRHETLKELEALGKELEHLSHIKESVEDKLELRRKQFHVLLSTIHELQQTLENDEKLSEVEEAQEASMETDPKP
Uniprot:: Q6I9Y2
Synonyms:: fSAP24;functional spliceosome-associated protein 24;hTREX30;Ngg1 interacting factor 3 like 1 binding protein 1;ngg1-interacting factor 3-like protein 1-binding protein 1;NIF3L1-binding protein 1;NIF3L1BP1;THO complex 7 homolog;THO complex subunit 7 homolog
Extra Details:: Predicted to enable RNA binding activity. Involved in mRNA export from nucleus and viral mRNA export from host cell nucleus. Located in cytosol and nuclear speck. Part of THO complex part of transcription export complex. Colocalizes with chromosome, telomeric region.