TNFAIP8L2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A13698
Additional Names:: TIPE2|TNFAIP8L2
Application:: ELISA, WB, IF, ICC, IP
Molecular Weight:: 18kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MESFSSKSLALQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRPQAQRVIKDLIKVAIKVAVLHRNGSFGPSELALATRFRQKLRQGAMTALSFGEVDFTFEAAVLAGLLTECRDVLLELVEHHLTPKSHGRIRHVFDHFSDPGLLTALYGPDFTQHLGKICDGLRKLLDEGKL
Uniprot:: Q6P589
Synonyms:: inflammation factor 20;inflammation factor protein 20;TIPE2;TNF alpha-induced protein 8-like protein 2;TNFAIP8-like protein 2;tumor necrosis factor alpha-induced protein 8-like protein 2;tumor necrosis factor, alpha induced protein 8 like 2;tumor necrosis factor, alpha-induced protein 8-like protein 2
Extra Details:: Predicted to be involved in negative regulation of T cell activation and negative regulation of inflammatory response. Predicted to be active in cytoplasm.