A13697
NOP16 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A13697
- Additional Names:
- HSPC111|HSPC185|NOP16
- Application:
- ELISA, WB
- Molecular Weight:
- 21kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MPKAKGKTRRQKFGYSVNRKRLNRNARRKAAPRIECSHIRHAWDHAKSVRQNLAEMGLAVDPNRAVPLRKRKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVRYMVENHGEDYKAMARDEKNYYQDTPKQIRSKINVYKRFYPAEWQDFLDSLQKRKMEVE
- Uniprot:
- Q9Y3C1
- Synonyms:
- HBV pre-S2 trans-regulated protein 3;HSPC111;HSPC185;hypothetical protein HSPC111;NOP16 nucleolar protein homolog;nucleolar protein 16;nucleolar protein 16 homolog
- Extra Details:
- This gene encodes a protein that is localized to the nucleolus. Expression of this gene is induced by estrogens and Myc protein and is a marker of poor patient survival in breast cancer. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice