A13688
NR5A2 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A13688
- Additional Names:
- B1F|B1F2|CPF|FTF|FTZ-F1|FTZ-F1beta|hB1F-2|LRH-1|LRH1|NR5A2
- Application:
- ELISA, WB, IHC-P, IF
- Molecular Weight:
- 61kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- SIPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMADQTLFSIVEWARSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVVHGKEGSIFLVTGQQVDYSIIASQAGATLNNLMSHAQELVAKLRSLQFDQREFVCLKFLVLFSLDVKNLENFQLVEGVQEQVNAALLDYTMCNYPQQTEKFGQLLLRLPEIRAISMQAEEYLYYKHLNGDVPYNNLLIEMLHAKRA
- Uniprot:
- O00482
- Synonyms:
- Alpha-1-fetoprotein transcription factor;B1-binding factor;b1-binding factor, hepatocyte transcription factor which activates enhancer II of hepatitis B virus;B1F;B1F2;CPF;CYP7A promoter-binding factor;fetoprotein-alpha 1 (AFP) transcription factor;FTF;FTZ-F1;FTZ-F1beta;hB1F-2;Hepatocytic transcription factor;hepatocytic transcription factor hB1F-3;liver nuclear receptor homolog-1 variant 2;Liver receptor homolog 1;LRH-1;LRH1;nuclear receptor subfamily 5 group A member 2
- Extra Details:
- The protein encoded by this gene is a DNA-binding zinc finger transcription factor and is a member of the fushi tarazu factor-1 subfamily of orphan nuclear receptors. The encoded protein is involved in the expression of genes for hepatitis B virus and cholesterol biosynthesis, and may be an important regulator of embryonic development.
- Shipping Conditions:
- Blue Ice