A13680
[KO Validated] PMS2 Rabbit polyclonal antibody

Size
POA
- SKU:
- A13680
- Additional Names:
- HNPCC4|LYNCH4|MLH4|MMRCS4|PMS-2|PMS2CL|PMSL2|S2
- Application:
- ELISA, WB, IF, ICC, IP
- Molecular Weight:
- 110kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- ADLEKPMVEKQDQSPSLRTGEEKKDVSISRLREAFSLRHTTENKPHSPKTPEPRRSPLGQKRGMLSSSTSGAISDKGVLRPQKEAVSSSHGPSDPTDRAEVEKDSGHGSTSVDSEGFSIPDTGSHCSSEYAASSPGDRGSQEHVDSQEKAPKTDDSFSDVDCHSNQEDTGCKFRVLPQPTNLATPNTKRFKKEEILSSSDICQKLVNTQDMSASQVDVAVKINKKVVPLDFSMSSLAKRIKQLHHEAQQSEGEQNYRKFRAKICPGENQAAEDELRKEISK
- Uniprot:
- P54278
- Synonyms:
- DNA mismatch repair protein PMS2;HNPCC4;mismatch repair endonuclease PMS2;MLH4;MMRCS4;PMS1 homolog 2, mismatch repair protein;PMS1 protein homolog 2;PMS2 postmeiotic segregation increased 2;PMS2CL;PMSL2;postmeiotic segregation increased 2 nirs variant 6
- Extra Details:
- The protein encoded by this gene is a key component of the mismatch repair system that functions to correct DNA mismatches and small insertions and deletions that can occur during DNA replication and homologous recombination. This protein forms heterodimers with the gene product of the mutL homolog 1 (MLH1) gene to form the MutL-alpha heterodimer. The MutL-alpha heterodimer possesses an endonucleolytic activity that is activated following recognition of mismatches and insertion/deletion loops by the MutS-alpha and MutS-beta heterodimers, and is necessary for removal of the mismatched DNA. There is a DQHA(X)2E(X)4E motif found at the C-terminus of the protein encoded by this gene that forms part of the active site of the nuclease. Mutations in this gene have been associated with hereditary nonpolyposis colorectal cancer (HNPCC; also known as Lynch syndrome) and Turcot syndrome.
- Shipping Conditions:
- Blue Ice
![[KO Validated] PMS2 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A13680/A13680_1.jpg)
![[KO Validated] PMS2 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A13680/A13680_2.jpg)
![[KO Validated] PMS2 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A13680/A13680_3.jpg)
![[KO Validated] PMS2 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A13680/A13680_4.jpg)
![[KO Validated] PMS2 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A13680/A13680_P3529_WB_01.jpg)
![[KO Validated] PMS2 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A13680/A13680_P3529_KO-WB_01.jpg)
![[KO Validated] PMS2 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A13680/A13680_P3529_IF_01.jpg)
![[KO Validated] PMS2 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A13680/A13680_P3529_IP_01.jpg)