KLF4 Rabbit monoclonal antibody

Size

POA

SKU:: A13673
Additional Names:: EZF|GKLF|KLF4
Application:: ELISA, WB, IHC-P, IF, ICC, IP
Molecular Weight:: 55 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: A synthetic peptide corresponding to a sequence within amino acids 300-400 of human KLF4 (O43474).
Formulation:: Unmodified
Sequence:: PAAHDFPLGRQLPSRTTPTLGLEEVLSSRDCHPALPLPPGFHPHPGPNYPSFLPDQMQPQVPPLHYQGQSRGFVARAGEPCVCWPHFGTHGMMLTPPSSPL
Uniprot:: O43474
Synonyms:: endothelial Kruppel-like zinc finger protein;epithelial zinc finger protein EZF;EZF;GKLF;gut Kruppel-like factor;gut-enriched krueppel-like factor;Krueppel-like factor 4;Kruppel-like factor 4 (gut)
Extra Details:: This gene encodes a protein that belongs to the Kruppel family of transcription factors. The encoded zinc finger protein is required for normal development of the barrier function of skin. The encoded protein is thought to control the G1-to-S transition of the cell cycle following DNA damage by mediating the tumor suppressor gene p53. Mice lacking this gene have a normal appearance but lose weight rapidly, and die shortly after birth due to fluid evaporation resulting from compromised epidermal barrier function. Alternative splicing results in multiple transcript variants encoding different isoforms.