A13645
MDA5 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A13645
- Additional Names:
- AGS7|Hlcd|IDDM19|IFIH1|IMD95|MDA-5|MDA5|RLR-2|SGMRT1
- Application:
- ELISA, WB, IHC-P, IF, ICC
- Molecular Weight:
- 135 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MSNGYSTDENFRYLISCFRARVKMYIQVEPVLDYLTFLPAEVKEQIQRTVATSGNMQAVELLLSTLEKGVWHLGWTREFVEALRRTGSPLAARYMNPELTDLPSPSFENAHDEYLQLLNLLQPTLVDKLLVRDVLDKCMEEELLTIEDRNRIAAAENNGNESGVRELLKRIVQKENWFSAFLNVLRQTGNNELVQELTGSDCSES
- Uniprot:
- Q9BYX4
- Synonyms:
- AGS7;CADM-140 autoantigen;clinically amyopathic dermatomyositis autoantigen 140 kDa;DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide;helicard;helicase with 2 CARD domains;Hlcd;IDDM19;interferon-induced helicase C domain-containing protein 1;Interferon-induced with helicase C domain protein 1;MDA-5;MDA5;melanoma differentiation-associated gene 5;melanoma differentiation-associated protein 5;murabutide down-regulated protein;RIG-I-like receptor 2;RLR-2;RNA helicase-DEAD box protein 116;SGMRT1
- Extra Details:
- IFIH1 encodes MDA5 which is an intracellular sensor of viral RNA that triggers the innate immune response. Sensing RNA length and secondary structure, MDA5 binds dsRNA oligonucleotides with a modified DExD/H-box helicase core and a C-terminal domain, thus leading to a proinflammatory response that includes interferons. It has been shown that Coronaviruses (CoVs) as well as various other virus families, are capable of evading the MDA5-dependent interferon response, thus impeding the activation of the innate immune response to infection. MDA5 has also been shown to play an important role in enhancing natural killer cell function in malaria infection. In addition to its protective role in antiviral responses, MDA5 has been implicated in autoimmune and autoinflammatory diseases such as type 1 diabetes, systemic lupus erythematosus, and Aicardi-Goutieres syndrome
- Shipping Conditions:
- Blue Ice