SLC34A1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A13635
Additional Names:: FRTS2|HCINF2|NAPI-3|NPHLOP1|NPT2|NPTIIa|SLC11|SLC17A2|SLC34A1
Application:: ELISA, WB
Molecular Weight:: 75-80kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: QSRSPGHLPKWLQTWDFLPRWMHSLKPLDHLITRATLCCARPEPRSPPLPPRVFLEELPPATPSPRLALPAHHNATRL
Uniprot:: Q06495
Synonyms:: FRTS2;HCINF2;Na(+)-dependent phosphate cotransporter 2A;Na(+)/Pi cotransporter 2A;Na+-phosphate cotransporter type II;naPi-2a;NAPI-3;NPHLOP1;NPT2;NPTIIa;renal sodium-dependent phosphate transporter;SLC11;SLC17A2;sodium-dependent phosphate transport protein 2A;sodium-phosphate transport protein 2A;sodium/phosphate co-transporter;sodium/phosphate cotransporter 2A;solute carrier family 17 (sodium phosphate), member 2;solute carrier family 34 (sodium phosphate), member 1;solute carrier family 34 (type II sodium/phosphate cotransporter), member 1;Solute carrier family 34 member 1
Extra Details:: Enables sodium:phosphate symporter activity. Involved in several processes, including phosphate ion homeostasis; phosphate ion transport; and response to lead ion. Located in several cellular components, including apical plasma membrane; mitotic spindle; and nuclear speck. Implicated in several diseases, including Fanconi syndrome (multiple); chronic kidney disease; hereditary hypophosphatemic rickets with hypercalciuria; hypophosphatemic nephrolithiasis/osteoporosis 1; and nephrolithiasis.

Shipping Conditions:: Blue Ice