PSMB2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A13630
Additional Names:: HC7-I|PSMB2
Application:: ELISA, WB, IHC-P, IF, ICC, IP
Molecular Weight:: 23kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQGS
Uniprot:: P49721
Synonyms:: HC7-I;macropain subunit C7-I;multicatalytic endopeptidase complex subunit C7-1;multicatalytic endopeptidase complex subunit C7-I;proteasome (prosome, macropain) subunit, beta type, 2;proteasome beta 2 subunit;proteasome component C7-I;proteasome subunit beta 2;proteasome subunit beta type-2;proteasome subunit beta4;proteasome subunit, beta type, 2;testicular tissue protein Li 152
Extra Details:: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Shipping Conditions:: Blue Ice