A13590
PHPT1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A13590
- Additional Names:
- CGI-202|HEL-S-132P|HSPC141|PHP|PHP14|PHPT1
- Application:
- ELISA, WB
- Molecular Weight:
- 13kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY
- Uniprot:
- Q9NRX4
- Synonyms:
- 14 kDa phosphohistidine phosphatase;CGI-202;epididymis secretory sperm binding protein Li 132P;HEL-S-132P;HSPC141;Phosphohistidine phosphatase 1;PHP;PHP14;protein histidine phosphatase;protein janus-A homolog;sex-regulated protein janus-a
- Extra Details:
- This gene encodes an enzyme that catalyzes the reversible dephosphorylation of histidine residues in proteins. It may be involved in the dephosphorylation of G-beta and ATP citrate lyase and in negatively regulating CD4 T lymphocytes by dephosphorylation and inhibition of KCa3.1 channels. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice

