RANKL Rabbit polyclonal antibody

Size

£152.00

SKU:: A13567
Additional Names:: CD254|hRANKL2|ODF|OPGL|OPTB2|RANKL|sOdf|TNLG6B|TRANCE
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 31kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: RISEDGTHCIYRILRLHENADFQDTTLESQDTKLIPDSCRRIKQAFQGAVQKELQHIVGSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID
Uniprot:: O14788
Synonyms:: CD254;hRANKL2;ODF;OPGL;OPTB2;osteoclast differentiation factor;osteoprotegerin ligand;RANKL;receptor activator of nuclear factor kappa B ligand;Receptor activator of nuclear factor kappa-B ligand;sOdf;TNF-related activation-induced cytokine;TNLG6B;TRANCE;tumor necrosis factor (ligand) superfamily, member 11;tumor necrosis factor ligand 6B;tumor necrosis factor ligand superfamily member 11;tumor necrosis factor superfamily member 11
Extra Details:: This gene encodes a member of the tumor necrosis factor (TNF) cytokine family which is a ligand for osteoprotegerin and functions as a key factor for osteoclast differentiation and activation. This protein was shown to be a dentritic cell survival factor and is involved in the regulation of T cell-dependent immune response. T cell activation was reported to induce expression of this gene and lead to an increase of osteoclastogenesis and bone loss. This protein was shown to activate antiapoptotic kinase AKT/PKB through a signaling complex involving SRC kinase and tumor necrosis factor receptor-associated factor (TRAF) 6, which indicated this protein may have a role in the regulation of cell apoptosis. Targeted disruption of the related gene in mice led to severe osteopetrosis and a lack of osteoclasts. The deficient mice exhibited defects in early differentiation of T and B lymphocytes, and failed to form lobulo-alveolar mammary structures during pregnancy. Two alternatively spliced transcript variants have been found.

Shipping Conditions:: Blue Ice