A13509
LRP1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A13509
- Additional Names:
- A2MR|APOER|APR|CD91|IGFBP-3R|IGFBP3R|IGFBP3R1|KPA|LRP|LRP1|LRP1A|TGFBR5
- Application:
- ELISA, WB
- Molecular Weight:
- 85 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- AIDAPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEAPEICPQSKAQRCQPNEHNCLGTELCVPMSRLCNGVQDCMDGSDEGPHCRELQGNCSRLGCQHHCVPTLDGPTCYCNSSFQLQADGKTCKDFDECSVYGTCSQLCTNTD
- Uniprot:
- Q07954
- Synonyms:
- A2MR;alpha-2-macroglobulin receptor;APOER;apolipoprotein E receptor;APR;CD91;IGFBP-3R;IGFBP3R;IGFBP3R1;KPA;low density lipoprotein receptor-related protein 1;LRP;LRP1A;prolow-density lipoprotein receptor-related protein 1;TbetaR-V/LRP-1/IGFBP-3 receptor;TGFBR5;type V tgf-beta receptor
- Extra Details:
- This gene encodes a member of the low-density lipoprotein receptor family of proteins. The encoded preproprotein is proteolytically processed by furin to generate 515 kDa and 85 kDa subunits that form the mature receptor (PMID: 8546712). This receptor is involved in several cellular processes, including intracellular signaling, lipid homeostasis, and clearance of apoptotic cells. In addition, the encoded protein is necessary for the alpha 2-macroglobulin-mediated clearance of secreted amyloid precursor protein and beta-amyloid, the main component of amyloid plaques found in Alzheimer patients. Expression of this gene decreases with age and has been found to be lower than controls in brain tissue from Alzheimer's disease patients.
- Shipping Conditions:
- Blue Ice

