Clusterin Rabbit polyclonal antibody

Size

£152.00

SKU:: A13479
Additional Names:: AAG4|APO-J|APOJ|CLI|CLU1|CLU2|Clusterin|KUB1|NA1/NA2|SGP-2|SGP2|SP-40|TRPM-2|TRPM2
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 38kDa/57kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: FPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE
Uniprot:: P10909
Synonyms:: AAG4;Aging-associated gene 4 protein;aging-associated protein 4;APO-J;APOJ;apolipoprotein J;CLI;CLU1;CLU2;clusterin;complement cytolysis inhibitor;complement lysis inhibitor;complement-associated protein SP-40,40;epididymis secretory sperm binding protein;ku70-binding protein 1;KUB1;NA1/NA2;SGP-2;SGP2;SP-40;sulfated glycoprotein 2;testosterone-repressed prostate message 2;TRPM-2;TRPM2
Extra Details:: The protein encoded by this gene is a secreted chaperone that can under some stress conditions also be found in the cell cytosol. It has been suggested to be involved in several basic biological events such as cell death, tumor progression, and neurodegenerative disorders. Alternate splicing results in both coding and non-coding variants.

Shipping Conditions:: Blue Ice