A13438
TBL1XR1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A13438
- Additional Names:
- C21|DC42|IRA1|MRD41|TBL1XR1|TBLR1
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 60kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- QQGSAKNGENTANGEENGAHTIANNHTDMMEVDGDVEIPPNKAVVLRGHES
- Uniprot:
- Q9BZK7
- Synonyms:
- C21;DC42;F-box-like/WD repeat-containing protein TBL1XR1;IRA1;MRD41;nuclear receptor co-repressor/HDAC3 complex subunit;nuclear receptor corepressor/HDAC3 complex subunit TBLR1;TBL1-related protein 1;TBLR1;transducin beta like 1 X-linked receptor 1;Transducin beta-like 1X-related protein 1
- Extra Details:
- This gene is a member of the WD40 repeat-containing gene family and shares sequence similarity with transducin (beta)-like 1X-linked (TBL1X). The protein encoded by this gene is thought to be a component of both nuclear receptor corepressor (N-CoR) and histone deacetylase 3 (HDAC 3) complexes, and is required for transcriptional activation by a variety of transcription factors. Mutations in these gene have been associated with some autism spectrum disorders, and one finding suggests that haploinsufficiency of this gene may be a cause of intellectual disability with dysmorphism. Mutations in this gene as well as recurrent translocations involving this gene have also been observed in some tumors.
- Shipping Conditions:
- Blue Ice