A13433
C10orf2 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A13433
- Additional Names:
- ATXN8|C10orf2|IOSCA|MTDPS7|PEO|PEO1|PEOA3|PRLTS5|SANDO|SCA8|TWINL
- Application:
- ELISA, WB
- Molecular Weight:
- 77kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- NVLILQDRKLVTGPGKRYLQVSKNRFDGDVGVFPLEFNKNSLTFSIPPKNKARLKKIKDDTGPVAKKPSSGKKGATTQNSEICSGQAPTPDQPDTSKRSK
- Uniprot:
- Q96RR1
- Synonyms:
- ataxin 8;ATXN8;C10orf2;IOSCA;MTDPS7;PEO;PEO1;PEOA3;PRLTS5;progressive external ophthalmoplegia 1 protein;SANDO;SCA8;T7 gp4-like protein with intramitochondrial nucleoid localization;T7 helicase-related protein with intramitochondrial nucleoid localization;T7-like mitochondrial DNA helicase;Twinkle mtDNA helicase;twinkle protein, mitochondrial;TWINL
- Extra Details:
- This gene encodes a hexameric DNA helicase which unwinds short stretches of double-stranded DNA in the 5' to 3' direction and, along with mitochondrial single-stranded DNA binding protein and mtDNA polymerase gamma, is thought to play a key role in mtDNA replication. The protein localizes to the mitochondrial matrix and mitochondrial nucleoids. Mutations in this gene cause infantile onset spinocerebellar ataxia (IOSCA) and progressive external ophthalmoplegia (PEO) and are also associated with several mitochondrial depletion syndromes. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
- Shipping Conditions:
- Blue Ice