[KO Validated] SOD2 Rabbit polyclonal antibody

Size

POA

SKU:: A1340
Additional Names:: D2|GC1|GClnc1|IPO-B|IPOB|Mn-SOD|MNSOD|MVCD6
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 25 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Uniprot:: P04179
Synonyms:: epididymis secretory sperm binding protein;gastric cancer-associated lncRNA 1;GClnc1;indophenoloxidase B;IPO-B;IPOB;manganese-containing superoxide dismutase;mangano-superoxide dismutase;Mn superoxide dismutase;Mn-SOD;MNSOD;MVCD6;superoxide dismutase [Mn], mitochondrial;superoxide dismutase 2, mitochondrial
Extra Details:: This gene is a member of the iron/manganese superoxide dismutase family. It encodes a mitochondrial protein that forms a homotetramer and binds one manganese ion per subunit. This protein binds to the superoxide byproducts of oxidative phosphorylation and converts them to hydrogen peroxide and diatomic oxygen. Mutations in this gene have been associated with idiopathic cardiomyopathy (IDC), premature aging, sporadic motor neuron disease, and cancer. Alternative splicing of this gene results in multiple transcript variants. A related pseudogene has been identified on chromosome 1.

Shipping Conditions:: Blue Ice