TGM1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A13359
Additional Names:: ARCI1|ICR2|KTG|LI|LI1|TGASE|TGK|TGM1
Application:: ELISA, WB
Molecular Weight:: 90kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: AGDGTIREGMLVVNGVDLLSSRSDQNRREHHTDEYEYDELIVRRGQPFHMLLLLSRTYESSDRITLELLIGNNPEVGKGTHVIIPVGKGGSGGWKAQVVKASGQNLNLRVHTSPNAIIGKFQFTVRTQSDAGEFQLPFDPRNEIYILFNPWCPEDIVYVDHEDWRQEYVLNESGRIYYGTE
Uniprot:: P22735
Synonyms:: ARCI1;epidermal TGase;ICR2;K polypeptide epidermal type I, protein-glutamine-gamma-glutamyltransferase;KTG;LI;LI1;protein-glutamine gamma-glutamyltransferase K;TG(K);TGASE;TGase K;TGase-1;TGK;transglutaminase K;Transglutaminase-1;transglutaminase, keratinocyte
Extra Details:: The protein encoded by this gene is a membrane protein that catalyzes the addition of an alkyl group from an akylamine to a glutamine residue of a protein, forming an alkylglutamine in the protein. This protein alkylation leads to crosslinking of proteins and catenation of polyamines to proteins. This gene contains either one or two copies of a 22 nt repeat unit in its 3' UTR. Mutations in this gene have been associated with autosomal recessive lamellar ichthyosis (LI) and nonbullous congenital ichthyosiform erythroderma (NCIE).

Shipping Conditions:: Blue Ice