A13339
POLR2H Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A13339
- Additional Names:
- POLR2H|RPABC3|RPB17|RPB8
- Application:
- ELISA, WB, IP
- Molecular Weight:
- 17kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF
- Uniprot:
- P52434
- Synonyms:
- DNA-directed RNA polymerase II subunit H;DNA-directed RNA polymerases I, II, and III 17.1 kDa polypeptide;DNA-directed RNA polymerases I, II, and III subunit RPABC3;polymerase (RNA) II (DNA directed) polypeptide H;polymerase (RNA) II subunit H;RNA polymerase II subunit H;RPABC3;RPB17;RPB8;RPB8 homolog
- Extra Details:
- The three eukaryotic RNA polymerases are complex multisubunit enzymes that play a central role in the transcription of nuclear genes. This gene encodes an essential and highly conserved subunit of RNA polymerase II that is shared by the other two eukaryotic DNA-directed RNA polymerases, I and III. Alternative splicing results in multiple transcript variants of this gene.
- Shipping Conditions:
- Blue Ice



