A13336
PCNA Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A13336
- Additional Names:
- ATLD2|PCNA
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 34kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- CAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS
- Uniprot:
- P12004
- Synonyms:
- ATLD2;cyclin;DNA polymerase delta auxiliary protein;proliferating cell nuclear antigen
- Extra Details:
- The protein encoded by this gene is found in the nucleus and is a cofactor of DNA polymerase delta. The encoded protein acts as a homotrimer and helps increase the processivity of leading strand synthesis during DNA replication. In response to DNA damage, this protein is ubiquitinated and is involved in the RAD6-dependent DNA repair pathway. Two transcript variants encoding the same protein have been found for this gene. Pseudogenes of this gene have been described on chromosome 4 and on the X chromosome.
- Shipping Conditions:
- Blue Ice








