LLGL2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A13323
Additional Names:: 9130006H11Rik|LLGL2|Llglh2
Application:: ELISA, WB
Molecular Weight:: 114kDa
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: DSTKAKKHNRPSNGNGTGLKMTSSGHVRNSKSQSDGDEKKPGPVMEHALLNDAWVLKEIQSTLEGDRRSYGNWHPHRVAVGCRLSNGEAE
Synonyms:: 9130006H11Rik;HGL;Hugl-2;human giant larvae homolog;lethal giant larvae homolog 2, scribble cell polarity complex component;lethal giant larvae-like protein 2;lethal(2) giant larvae protein homolog 2;LGL2;LLGL scribble cell polarity complex component 2;LLGL2, scribble cell polarity complex component;Llglh2
Extra Details:: Predicted to enable GTPase activator activity; PDZ domain binding activity; and myosin II binding activity. Acts upstream of or within establishment or maintenance of polarity of embryonic epithelium; labyrinthine layer development; and post-embryonic development. Predicted to be located in cytosol and intracellular membrane-bounded organelle. Predicted to be active in cortical actin cytoskeleton and plasma membrane. Is expressed in several structures, including cardiovascular system; endocrine gland; genitourinary system; gut; and nasal cavity epithelium. Orthologous to human LLGL2 (LLGL scribble cell polarity complex component 2).

Shipping Conditions:: Blue Ice