A13215
VPS54 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A13215
- Additional Names:
- HCC8|hVps54L|PPP1R164|SLP-8p|VPS54|VPS54L|WR
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 110kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- VVKLADQMRMLNFPQWFDLLKDIFSKFTIFLQRVKATLNIIHSVVLSVLDKNQRTRELEEISQQKNAAKDNSLDTEVAYLIHEGMFISDAFGEGELTPIAVDTTSQRNASPNSEPCSSDSVSEPECTTDSSSSKEHTSSSAIPGGVDIMVSEDMKLTDSELGKLANNIQELLYSASDICHDRAVKFLMSRAKDGFLEKLNSMEFITLSRLMETFILDTEQICGRKSTSLLGALQSQAIKFVNRFHEERKTKLSLLLDNERWKQADVPAEFQDLVDSLSDGKIALPEKKSGATEERKPAEVL
- Uniprot:
- Q9P1Q0
- Synonyms:
- HCC8;hepatocellular carcinoma protein 8;hVps54L;PPP1R164;protein phosphatase 1, regulatory subunit 164;SLP-8p;tumor antigen HOM-HCC-8;tumor antigen SLP-8p;vacuolar protein sorting 54 homolog;vacuolar protein sorting-associated protein 54;VPS54, GARP complex subunit;VPS54L;WR
- Extra Details:
- This gene encodes for a protein that in yeast forms part of a trimeric vacuolar-protein-sorting complex that is required for retrograde transport of proteins from prevacuoles to the late Golgi compartment. As in yeast, mammalian Vps54 proteins contain a coiled-coil region and dileucine motifs. Alternative splicing results in multiple transcript variants encoding different isoforms
- Shipping Conditions:
- Blue Ice

