A13189
LSM3 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A13189
- Additional Names:
- LSM3|SMX4|USS2|YLR438C
- Application:
- ELISA, WB
- Molecular Weight:
- 12kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKRNIPMLFVRGDGVVLVAPPLRVG
- Uniprot:
- P62310
- Synonyms:
- LSM3 homolog, U6 small nuclear RNA associated;LSM3 U6 small nuclear RNA and mRNA degradation associated;SMX4;U6 snRNA-associated Sm-like protein LSm3;USS2;YLR438C
- Extra Details:
- Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.
- Shipping Conditions:
- Blue Ice