A13186
CADPS Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A13186
- Additional Names:
- CADPS|CADPS1|CAPS|CAPS1|UNC-31
- Application:
- ELISA, WB
- Molecular Weight:
- 153kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MASDMIESCVKRTRIAFEVKLQKTSRSTDFRVPQSICTMFNVMVDAKAQSTKLCSMEMGQEHQYHSKIDELIEETVKEMIT
- Uniprot:
- Q9ULU8
- Synonyms:
- Ca++-dependent secretion activator;Ca2+ dependent secretion activator;Ca2+-dependent activator protein for secretion;Ca2+-regulated cytoskeletal protein;CADPS1;calcium-dependent activator protein for secretion 1;calcium-dependent secretion activator 1;CAPS;CAPS-1;CAPS1;UNC-31
- Extra Details:
- This gene encodes a novel neural/endocrine-specific cytosolic and peripheral membrane protein required for the Ca2+-regulated exocytosis of secretory vesicles. The protein acts at a stage in exocytosis that follows ATP-dependent priming, which involves the essential synthesis of phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2). Alternative splicing has been observed at this locus and three variants, encoding distinct isoforms, are described.
- Shipping Conditions:
- Blue Ice

