KLF10 Rabbit polyclonal antibody

Size

£152.00

SKU:: A13180
Additional Names:: EGR-alpha|EGRA|KLF10|TIEG|TIEG1
Application:: ELISA, WB
Molecular Weight:: 56kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MKAASILNYQNNSFRRRTHLNVEAARKNIPCAAVSPNRSKCERNTVADVDEKASAALYDFSVPSSETVICRSQPAPVSPQQKSVLVSPPAVSAGGVPPMPVICQMVPLPANNPVVTTVVPSTPPSQPPAVCPPVVFMGTQVPKGAVMFVVPQPVVQSSKPPVVSPNGTRLSPIAPAPGFSPSAAKVTPQIDSSRIRSHICSHPGC
Uniprot:: Q13118
Synonyms:: early growth response-alpha;EGR-alpha;EGRA;Krueppel-like factor 10;TGFB-inducible early growth response protein 1;TIEG;TIEG1;transforming growth factor-beta-inducible early growth response protein 1;zinc finger transcription factor TIEG
Extra Details:: This gene encodes a member of a family of proteins that feature C2H2-type zinc finger domains. The encoded protein is a transcriptional repressor that acts as an effector of transforming growth factor beta signaling. Activity of this protein may inhibit the growth of cancers, particularly pancreatic cancer. Alternative splicing results in multiple transcript variants.