A1316
IL-1 alpha Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A1316
- Additional Names:
- IL-1 alpha|IL-1A|IL1|IL1-ALPHA|IL1F1
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 31 kDa/21 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQIL
- Uniprot:
- P01583
- Synonyms:
- hematopoietin-1;IL-1 alpha;IL-1A;IL1;IL1-ALPHA;IL1F1;interleukin-1 alpha;preinterleukin 1 alpha;pro-interleukin-1-alpha
- Extra Details:
- The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. This cytokine is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. It has been suggested that the polymorphism of these genes is associated with rheumatoid arthritis and Alzheimer's disease.
- Shipping Conditions:
- Blue Ice







