RBM14 Rabbit polyclonal antibody

Size

£152.00

SKU:: A13159
Additional Names:: COAA|PSP2|RBM14|SIP|SYTIP1|TMEM137
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 75kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: VVKDYAFVHMEKEADAKAAIAQLNGKEVKGKRINVELSTKGQKKGPGLAVQSGDKTKKPGAGDTAFPGTGGFSATFDYQQAFGNSTGGFDGQARQPTPPFFGRDRSPLRRS
Uniprot:: Q96PK6
Synonyms:: COAA;COAZ;paraspeckle protein 2;PSP2;RBM14;RBM14-RBM4 protein;RBM14/RBM4 fusion;RNA-binding motif protein 14;RNA-binding protein 14;RRM-containing coactivator activator/modulator;SIP;synaptotagmin-interacting protein;SYT-interacting protein;SYTIP1;TMEM137;transcriptional coactivator CoAZ;transmembrane protein 137
Extra Details:: This gene encodes a ribonucleoprotein that functions as a general nuclear coactivator, and an RNA splicing modulator. This protein contains two RNA recognition motifs (RRM) at the N-terminus, and multiple hexapeptide repeat domain at the C-terminus that interacts with thyroid hormone receptor-binding protein (TRBP), and is required for transcription activation. Alternatively spliced transcript variants encoding different isoforms (with opposing effects on transcription) have been described for this gene.