A13157
PRDM2 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A13157
- Additional Names:
- HUMHOXY1|KMT8|KMT8A|MTB-ZF|PRDM2|RIZ|RIZ1|RIZ2
- Application:
- ELISA, WB
- Molecular Weight:
- 300kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MNQNTTEPVAATETLAEVPEHVLRGLPEEVRLFPSAVDKTRIGVWATKPILKGKKFGPFVGDKKKRSQVKNNVYMWEVYYPNLGWMCIDATDPEKGNWLRYVNWACSGEEQNLFPLEINRAIYYKTLKPIAPGEELLVWYNGEDNPEIAAAIEEERASARSKRSSPKSRKGKKKSQ
- Uniprot:
- Q13029
- Synonyms:
- GATA-3 binding protein G3B;GATA-3-binding protein G3B;HUMHOXY1;KMT8;KMT8A;lysine N-methyltransferase 8;MTB-ZF;MTE-binding protein;PR domain 2;PR domain containing 2, with ZNF domain;PR domain zinc finger protein 2;PR domain-containing protein 2;retinoblastoma protein-binding zinc finger protein;retinoblastoma protein-interacting zinc finger protein;RIZ;RIZ1;RIZ2;zinc finger protein RIZ;zinc-finger DNA-binding protein
- Extra Details:
- This tumor suppressor gene is a member of a nuclear histone/protein methyltransferase superfamily. It encodes a zinc finger protein that can bind to retinoblastoma protein, estrogen receptor, and the TPA-responsive element (MTE) of the heme-oxygenase-1 gene. Although the functions of this protein have not been fully characterized, it may (1) play a role in transcriptional regulation during neuronal differentiation and pathogenesis of retinoblastoma, (2) act as a transcriptional activator of the heme-oxygenase-1 gene, and (3) be a specific effector of estrogen action. Multiple transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice