A13119
RBM26 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A13119
- Additional Names:
- ARRS2|C13orf10|PPP1R132|PRO1777|RBM26|SE70-2|ZC3H17
- Application:
- ELISA, WB
- Molecular Weight:
- 113kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- TQIFVEKLFDAVNTKSYLPPPEQPSSGSLKVEFFPHQEKDIKKEEITKEEEREKKFSRRLNHSPPQSSSRYRENRS
- Uniprot:
- Q5T8P6
- Synonyms:
- acidic rich RS domain containing 2;ARRS2;C13orf10;CTCL tumor antigen se70-2;cutaneous T-cell lymphoma tumor antigen se70-2;PPP1R132;PRO1777;protein phosphatase 1, regulatory 132;RNA-binding motif protein 26;RNA-binding protein 26;SE70-2;ZC3H17
- Extra Details:
- Enables RNA binding activity. Predicted to be involved in mRNA processing. Predicted to be active in nucleus.
- Shipping Conditions:
- Blue Ice