A13118
TSPYL2 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A13118
- Additional Names:
- CDA1|CINAP|CTCL|DENTT|HRIHFB2216|NP79|SE204|TSPX|TSPYL2
- Application:
- ELISA, WB
- Molecular Weight:
- 110kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LKRKFIQMRRPFLERRDLIIQHIPGFWVKAFLNHPRISILINRRDEDIFRYLTNLQVQDLRHISMGYKMKLYFQTNPYFTNMVIVKEFQRNRSGRLVSHSTPIRWHRGQEPQARRHGNQDASHSFFSWFSNHSLPEADRIAEIIKNDLWVNPLRYYLRERGSRIKRKKQEMKKRKTRGRCEVVIMEDAPDYYAVEDIFSEISDIDETIHDIKISDFMETTD
- Uniprot:
- Q9H2G4
- Synonyms:
- CASK-interacting nucleosome assembly protein;CDA1;cell division autoantigen 1;CINAP;CTCL;CTCL tumor antigen se20-4;CTCL-associated antigen se20-4;cutaneous T-cell lymphoma-associated antigen se20-4;cutaneous T-cell lymphoma-associated tumor antigen se20-4;DENTT;differentially expressed nucleolar TGF-beta1 target;differentially-expressed nucleolar TGF-beta1 target protein;HRIHFB2216;NP79;nuclear protein of 79 kDa;SE204;testis-specific protein Y encoded-like 2;testis-specific Y-encoded-like protein 2;TSPX;TSPY-like protein 2
- Extra Details:
- This gene encodes a member of the testis-specific protein Y-encoded, TSPY-like/SET/nucleosome assembly protein-1 superfamily. The encoded protein is localized to the nucleolus where it functions in chromatin remodeling and as an inhibitor of cell-cycle progression. This protein may play a role in the suppression of tumor growth.
- Shipping Conditions:
- Blue Ice