A13112
NLN Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A13112
- Additional Names:
- AGTBP|EP24.16|MEP|MOP|NLN
- Application:
- ELISA, WB
- Molecular Weight:
- 70kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- DGQYYGYLWSEVFSMDMFYSCFKKEGIMNPEVGMKYRNLILKPGGSLDGMDMLHNFLKREPNQKAFLMSRGLHAP
- Uniprot:
- Q9BYT8
- Synonyms:
- AGTBP;angiotensin binding protein;Angiotensin-binding protein;endopeptidase 24.16;EP24.16;MEP;microsomal endopeptidase;mitochondrial oligopeptidase M;MOP;neurolysin (metallopeptidase M3 family);neurolysin, mitochondrial;neurotensin endopeptidase
- Extra Details:
- This gene encodes a member of the metallopeptidase M3 protein family that cleaves neurotensin at the Pro10-Tyr11 bond, leading to the formation of neurotensin(1-10) and neurotensin(11-13). The encoded protein is likely involved in the termination of the neurotensinergic signal in the central nervous system and in the gastrointestinal tract.
- Shipping Conditions:
- Blue Ice