A13080
NUP160 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A13080
- Additional Names:
- NPHS19|NUP160
- Application:
- ELISA, WB
- Molecular Weight:
- 150kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- ALERSFVELSGAERERPRHFREFTVCSIGTANAVAGAVKYSESAGGFYYVESGKLFSVTRNRFIHWKTSGDTLELMEESLDINLLNNAIRLKFQNCSVLPGGVYVSETQNR
- Uniprot:
- Q12769
- Synonyms:
- 160 kDa nucleoporin;NPHS19;nuclear pore complex protein Nup160;nucleoporin 160kD;nucleoporin 160kDa;nucleoporin Nup160
- Extra Details:
- A structural constituent of nuclear pore. Involved in mRNA export from nucleus and nephron development. Part of nuclear pore outer ring. Colocalizes with kinetochore. Implicated in nephrotic syndrome type 19.
- Shipping Conditions:
- Blue Ice

