[KO Validated] GCN1L1 Rabbit polyclonal antibody

Size

POA

SKU:: A13075
Additional Names:: GCN1L|GCN1L1|L1|PRIC295
Application:: ELISA, WB
Molecular Weight:: 293kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LSAVLQQCLLADVSGIDWMVRHGRSLALSVAVNVAPGRLCAGRYSSDVQEMILSSATADRIPIAVSGVRGMGFLMRHHIETGGGQLPAKLSSLFVKCLQNPSSDIRLVAEKMIWWANKDPLPPLDPQAIKPILKALLDNTKDKNTVVRAYSDQAIVNLLKMRQGEEVFQSLSKILDVASLEVLNEVNRRSLKKLASQADSTEQVDDTILT
Uniprot:: Q92616
Synonyms:: eIF-2-alpha kinase activator GCN1;GCN1 (general control of amino-acid synthesis 1, yeast)-like 1;GCN1 eIF-2-alpha kinase activator homolog;GCN1 general control of amino-acid synthesis 1-like 1;GCN1-like protein 1;GCN1, eIF2 alpha kinase activator homolog;GCN1L;GCN1L1;general control of amino-acid synthesis 1-like protein 1;hsGCN1;peroxisome proliferator activated receptor interacting complex protein;PRIC295;translational activator GCN1
Extra Details:: Enables RNA binding activity and cadherin binding activity. Predicted to be involved in cellular response to leucine starvation and positive regulation of transcription from RNA polymerase II promoter in response to stress. Located in cytosol.